Skip to main content
Download PDF
  • Research article
  • Open access
  • Published:

SARS-CoV-2 spike protein S1 activates Cx43 hemichannels and disturbs intracellular Ca2+ dynamics

Biological Research volume 56, Article number: 56 (2023) Cite this article

Abstract

Background

Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) causes the ongoing coronavirus disease 2019 (COVID-19). An aspect of high uncertainty is whether the SARS-CoV-2 per se or the systemic inflammation induced by viral infection directly affects cellular function and survival in different tissues. It has been postulated that tissue dysfunction and damage observed in COVID-19 patients may rely on the direct effects of SARS-CoV-2 viral proteins. Previous evidence indicates that the human immunodeficiency virus and its envelope protein gp120 increase the activity of connexin 43 (Cx43) hemichannels with negative repercussions for cellular function and survival. Here, we evaluated whether the spike protein S1 of SARS-CoV-2 could impact the activity of Cx43 hemichannels.

Results

We found that spike S1 time and dose-dependently increased the activity of Cx43 hemichannels in HeLa-Cx43 cells, as measured by dye uptake experiments. These responses were potentiated when the angiotensin-converting enzyme 2 (ACE2) was expressed in HeLa-Cx43 cells. Patch clamp experiments revealed that spike S1 increased unitary current events with conductances compatible with Cx43 hemichannels. In addition, Cx43 hemichannel opening evoked by spike S1 triggered the release of ATP and increased the [Ca2+]i dynamics elicited by ATP.

Conclusions

We hypothesize that Cx43 hemichannels could represent potential pharmacological targets for developing therapies to counteract SARS-CoV-2 infection and their long-term consequences.

Background

Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) causes the ongoing coronavirus disease 2019 (COVID-19). Since its first detection in late 2019 (Wuhan, China), SARS-CoV-2 has persistently and seriously challenged global human health and economy [1]. The spread of SARS-CoV-2 is usually through the droplet spray produced by coughing, sneezing, and talking. Most people with COVID-19 are either asymptomatic or experience mild symptoms, including anosmia (loss of smell), fever, fatigue, headache, cough, muscle aches, and loss of appetite [2]. Nevertheless, in specific susceptible populations, SARS-CoV-2 infection can develop into a severe type of pneumonia which, if not adequately treated, could lead to acute respiratory distress syndrome, a life-threatening form of respiratory failure [3]. Predictive models estimate that SARS-CoV-2 infection has been implicated in 18.2 million deaths worldwide [4].

Although most individuals fully recover from COVID-19, some people experience the persistence of symptoms beyond three months of SARS-CoV-2 infection, lasting at least two months [5]. This condition has been referred to as “long-COVID” or “post-acute COVID syndrome” and commonly includes fatigue, breathlessness, post-exertional malaise, “brain fog”, headaches, nausea, vomiting, anxiety, depression, skin rash, joint pain, and palpitations [6, 7]. Long-COVID does not rely on persistent infection and develops regardless of the severity of the initial symptoms [8]. It is not yet known how persistent symptoms of long-COVID will last, but recent studies suggest that it may depend on antigen persistence and sustained specific immune responses to SARS-CoV-2 [9]. This background positions long-COVID as the “next health disaster” worldwide [10].

An aspect of high uncertainty is whether the SARS-CoV-2 per se or the systemic inflammation induced by viral infection directly affects cellular function and survival in different tissues [11]. In this context, it has been postulated that tissue dysfunction and damage observed in COVID-19 patients may rely on the direct effects of SARS-CoV-2 viral proteins [12,13,14,15]. Structurally, SARS-CoV-2 is a linear, positive-sense, single-stranded RNA-enveloped virus formed by four proteins: the spike, envelope, membrane, and nucleocapsid proteins [16]. The spike protein allows the virus to infect mammalian host cells by engaging the angiotensin-converting enzyme 2 (ACE2) receptor. Two monomeric subunits, S1 and S2, comprise the spike protein. The S1 subunit contains the binding domain that attaches to the ACE2 receptor. In contrast, the S2 subunit mediates the fusion of viral and cell membranes via its cleavage by diverse host proteases, including transmembrane serine protease 2 and cathepsins [17]. The latter eventually could produce the detachment of the S1 subunit (or spike protein S1 [spike S1]) and its release into the interstitium and blood plasma, from where it can reach different tissues, including the nervous system [12, 13, 18]. Serum levels of spike S1 correlate with the severity of COVID-19 disease [19] and are higher in individuals with ongoing long-COVID [20]. The spike S1 causes endothelial dysfunction [21, 22] and activates the complement system leading to platelet aggregation [23]. This viral protein disrupts the function of human cardiac pericytes [24] and the blood-brain barrier [25], whereas it also induces cognitive deficit and anxiety-like behaviors in vivo [14]. With this in mind, it has been proposed that acute and long-lasting symptoms of COVID-19 patients may originate from the direct action of spike S1 [12]. However, the mechanisms by which this viral protein could disturb cellular function remain to be fully elucidated.

Multiple studies have demonstrated that dysregulation of connexin hemichannel signaling contributes to cellular dysfunction with potentially detrimental consequences for tissue and organ homeostasis [26,27,28,29,30,31]. Connexin hemichannels belong to a family of large-pore channels formed by the transmembrane proteins called connexins [32]. Six monomers of these proteins oligomerize around a central pore to form a connexon or connexin hemichannel, which allows the ionic and molecular exchange between the cytoplasm and the extracellular space [33]. Within this family of channels, those formed by the connexin 43 (Cx43) are the most ubiquitous and play essential roles in the autocrine/paracrine signaling in various organs and systems [34,35,36,37]. Indeed, the diffusion of paracrine biomolecules and ions through Cx43 hemichannels, including Ca2+, ATP, PGE2, glucose and glutamate, contributes to the coordination and synchronization of Ca2+ wave propagation [38, 39], cell migration and proliferation [40, 41], cardiac excitability [42], synaptic transmission [43, 44] and memory consolidation [45,46,47]. Nevertheless, under pathological conditions, the persistent and exacerbated opening of connexin hemichannels causes the release of potentially harmful molecules (e.g., ATP, glutamate), cytosolic Ca2+ ([Ca2+]i) overload and/or loss of ionic and osmotic balance [27, 30, 48].

Previous research has found a link between the activation of connexin hemichannels and virus infection. For instance, the human immunodeficiency virus (HIV) and its envelope protein (gp120) increase the activity of Cx43 hemichannels with negative repercussions for cellular function and survival [49, 50]. However, it is still unknown whether SARS-CoV-2 or its viral proteins, including spike S1, could impact the function of Cx43 hemichannels. Here, we demonstrate that spike S1 augments the activity of Cx43 hemichannels, this response being potentiated by ACE2 receptors. Moreover, this viral protein distinctively modulated ATP-mediated [Ca2+]i dynamics depending on the presence of Cx43 and/or ACE2 receptors.

Results

Spike S1 increases the activity of Cx43 hemichannels

Previous studies have demonstrated that diverse pathogens augment the function of Cx43 hemichannels, including the HIV virion [49], the envelope HIV protein gp120 [50], lipopolysaccharide [51,52,53] and peptidoglycan [54]. With this in mind, we examined whether spike S1 could affect the function of Cx43 hemichannels expressed in HeLa cells. These cells transfected with Cx43 alone or tagged with fluorescent proteins express hemichannels at the cell surface, through which they take up and release small molecules, including dyes commonly used to assay hemichannel activity [55,56,57]. Thus, the functional state of Cx43 hemichannels was studied by recording the uptake of ethidium (Etd) in HeLa cells expressing Cx43 tagged with GFP (HeLa-Cx43GFP). Etd is a probe that crosses the plasma cell membrane by diffusing through large-pore channels such as hemichannels [58]. Once in the intracellular space, it binds to nucleic acids, emitting fluorescence equivalent to the function or activity of hemichannels. We found that spike S1 elicited a significant time-dependent increase in Etd uptake that peaked following 24 h of treatment in HeLa-Cx43GFP cells (Fig. 1A-G). Moreover, this response was concentration-dependent, reaching the highest value with 50 pM spike S1 that gradually declined over greater concentrations (Fig. 1B). In contrast, acute incubation with spike S1 failed to elevate Etd uptake in HeLa-Cx43GFP cells (Fig. 1H and I). On the other hand, the stimulus with spike S1 (50-1000 pM) for 24 h did not alter the Etd uptake in HeLa-parental cells, revealing that spike S1 increases specifically the activity of Cx43 hemichannels in HeLa cells (Fig. 1J).

Fig. 1
figure 1

Spike S1 augments the activity of Cx43 hemichannels. (A) Averaged Etd uptake rate normalized with the control condition (dashed line) by HeLa-Cx43GFP cells treated for several periods with 10 pM (blue circles) or 50 pM (red circles) spike S1. *p < 0.05, **p < 0.01; effect of spike S1 compared to control (two-way ANOVA followed by Tukey’s post-hoc test). (B) Averaged Etd uptake rate normalized with the control condition (dashed line) by HeLa-Cx43GFP cells treated for 24 h with different concentrations of spike S1. *p < 0.05, **p < 0.01; effect of spike S1 compared to control (one-way ANOVA followed by Tukey’s post-hoc test). (C-D) Representative images depicting the phase view merged with Cx43GFP (green) and Etd (red, 5 µM and 10 min of exposure) labeling by HeLa-Cx43GFP cells under control conditions (C) or treated with 50 pM spike S1 for 24 h (D). (E-F) Etd staining by HeLa-Cx43GFP cells showed in C and D. (G) Time-lapse measurements of Etd uptake by HeLa-Cx43GFP cells under control conditions (white circles) or treated with 50 pM spike S1 for 24 h (red circles). (H) Time-lapse measurements of Etd uptake by HeLa-Cx43GFP cells under control conditions acutely stimulated with 50 pM spike S1. Etd fluorescence was recorded in basal conditions for 3 min (white outline) and then an acute stimulation was performed during the following 5 min (red outline). (I) Averaged Etd uptake rate normalized with the control condition (dashed line) by HeLa-Cx43GFP cells acutely stimulated with different concentrations of spike S1. (J) Averaged Etd uptake rate normalized with the control condition (dashed line) by HeLa-parental cells treated for 24 h with different concentrations of spike S1. Data were obtained from at least three independent experiments with three or more repeats each (≥ 20 cells analyzed for each repeat). Calibration bar = 12 μm

Full size image

ACE2 potentiates spike S1-induced activity of Cx43 hemichannels

One widely accepted fact is that the spike S1 subunit possesses a receptor-binding domain that identifies ACE2 as its receptor [1, 59]. To examine whether ACE2 could contribute to the spike S1-induced activity of Cx43 hemichannels, we transfected HeLa cells, which lack endogenous ACE2 expression [1], with Cx43GFP plus the human ACE2 tagged with mCherry (HeLa-Cx43GFP/ACE2mCherry). Because the mCherry tag of ACE2 impeded us from performing dye uptake experiments with Etd (due to similar emission wavelengths), we used DAPI, another well-known tracer employed for measuring Cx43 hemichannel activity [56, 60]. Stimulation with a divalent cation-free solution (DCFS) increases Cx43 hemichannel opening within seconds [57]; thereby, we used this condition to explore the status of DAPI uptake in Hela-Cx43GFP/ACE2mCherry cells. Both Hela-Cx43GFP and Hela-Cx43GFP/ACE2mCherry cells showed a ~ 4.5-fold increase in DAPI uptake when stimulated with a DCFS (Fig. 2A). As expected, DCFS conditions did not augment DAPI uptake in Hela-parental or Hela-ACE2mCherry cells, showing that DCFS-mediated membrane permeabilization to DAPI requires the presence of Cx43 (Fig. 2A). Similar to that observed with Etd, treatment with 50 pM spike S1 for 24 h resulted in a significant increase in DAPI uptake in both HeLa-Cx43GFP and Hela-Cx43GFP/ACE2mCherry cells (Fig. 2B-H). These responses were more prominent in Hela-Cx43GFP/ACE2mCherry cells than HeLa-Cx43GFP cells but not observed in Hela-parental or HeLa-ACE2 mCherry cells (Fig. 2H).

Fig. 2
figure 2

The activation of Cx43 hemichannels induced by spike S1 is potentiated by ACE2. (A) Averaged DAPI uptake rate by HeLa-parental, HeLa-Cx43GFP, HeLa-Cx43GFP/ACE2mCherry or HeLa-ACE2mCherry cells bathed with normal saline (control, white bars) or a divalent cation-free solution (DCFS, yellow bars). ***p < 0.001; effect of DCFS compared to control (two-way ANOVA followed by Tukey’s post-hoc test). (B-C) Representative images depicting the phase view merged with Cx43GFP (green), ACE2mCherry (red), and DAPI (blue, 10 µM and 10 min of exposure) labeling by HeLa-Cx43GFP/ACE2mCherry cells under control conditions (B) or treated with 50 pM spike S1 for 24 h (C). (D-E) Cx43GFP and ACE2mCherry labeling by Cx43GFP/ACE2mCherry cells showed in B and C. (F-G) DAPI staining by Cx43GFP/ACE2mCherry cells shown in B and C. (H) Averaged DAPI uptake rate normalized with the control condition (dashed line) by HeLa-parental, HeLa-Cx43GFP, HeLa-Cx43GFP/ACE2mCherry or HeLa-ACE2mCherry cells treated with 50 pM spike S1 for 24 h. *p < 0.05, **p < 0.01; effect of spike S1 compared to control (one-way ANOVA followed by Tukey’s post-hoc test). (I) Time-lapse measurements of DAPI uptake by HeLa-Cx43GFP/ACE2mCherry cells under control conditions (white circles) or treated with 50 pM spike S1 for 24 h (red circles). (J) Averaged DAPI uptake rate normalized to the maximum effect evoked by spike S1 (dashed line) by HeLa-Cx43GFP cells acutely stimulated with different concentrations of spike S1. (J) Averaged DAPI uptake rate normalized with the control condition (dashed line) by HeLa-Cx43GFP/ACE2mCherry cells treated with 50 pM spike S1 for 24 h plus gap19 (100 µM), TAT-L2 (200 µM) or 10panx1 (100 µM). ***p < 0.001; effect of spike S1 vs. blockers (one-way ANOVA followed by Tukey’s post-hoc test). Data were obtained from at least three independent experiments with three or more repeats each (≥ 20 cells analyzed for each repeat). Calibration bar = 8 μm

Full size image

Next, we employed a pharmacological approach to support the involvement of Cx43 hemichannels in the spike S1-mediated DAPI uptake. Thus, gap19 (100 µM) or TAT-L2 (100 µM), two inhibitory mimetic peptides with sequences equivalent to intracellular L2 loop regions of Cx43 [61, 62]; completely suppressed the spike S1-induced DAPI uptake in Hela-Cx43GFP/ACE2mCherry cells (Fig. 2J). DAPI is capable of penetrating the plasma membrane by passing through hemichannels formed by pannexin-1 (Panx1) [63], which are large-pore channels that share some of the characteristics and functions of connexin hemichannels [64]. Since Panx1 hemichannels were recently reported to be activated by the SARS-CoV-2 virus, we seek to rule out their participation in the uptake of DAPI induced by the spike S1 [65]. 10panx1 (100 µM), a blocking mimetic peptide with an amino acid sequence homologous to the first extracellular loop domain of Panx1 [66] failed to reduce the DAPI uptake evoked by spike S1 in Hela-Cx43GFP/ACE2mCherry cells (Fig. 2J). To confirm the stimulatory effect of spike S1 on Cx43 hemichannel activity, we conducted whole-cell voltage-clamp experiments and recorded macroscopic membrane currents in Hela-Cx43GFP/ACE2mCherry cells. Unitary current transitions were nearly undetectable at resting potentials in control Hela-Cx43GFP/ACE2mCherry cells (Fig. 3A). However, the treatment with 50 pM spike S1 for 24 h induced several discrete unitary current events with conductances close to ~ 160 pS, ~ 250 pS or ~ 350 pS (Fig. 3B and C). These subconductances agree with those reported for GFP-Cx43 hemichannels expressed in C6 and HEK293 cells or reconstituted in planar lipid bilayers [67,68,69]. Consistent with this, the macroscopic currents triggered by spike S1 were significantly inhibited by the hemichannel blocker La3+ (200 µM) and did not occur when high extracellular Ca2+ was added to the bath solution (Fig. 3D). The latter is a well-known condition that reduces the open probability of Cx43 hemichannels [69]. Overall, these findings indicate that spike S1 boosts the activity of Cx43 hemichannels, this response being potentiated by ACE2.

Fig. 3
figure 3

Spike S1 augments ionic currents associated to Cx43 hemichannels. (A-B) Whole-cell voltage-clamp recordings at -40 mV in HeLa-Cx43GFP/ACE2mCherry cells under control conditions (A) or treated with 50 pM spike S1 for 24 h (B). (C) Expanded view of unitary current events depicted in the green squares (E1-E3) of the current trace in B. The frequency (counts) distribution of conductance values is also shown, corresponding to ∼250 pS, ∼160 pS and ∼350 pS. (D) Voltage ramps from − 80 to + 80 mV in HeLa-Cx43GFP/ACE2mCherry cells treated with 50 pM spike S1 for 24 h alone (black line), in combination with 200 µM La3+ (red line) or plus 10 mM extracellular Ca2+ (blue line)

Full size image

Spike S1 reduces gap junctional communication

Cell-to-cell communication mediated by gap junctions is crucial for propagating intercellular Ca2+ waves to ensure proper cellular function and coordination [70]. Given that increased hemichannel opening induced by inflammatory conditions occurs along with the decrease in dye coupling [60], we investigated whether the functional state of gap junctions was affected by spike S1 in our setup. To examine gap junctional communication the scrape loading/dye transfer (SL/DT) technique was employed using DAPI. The treatment with 50 pM spike S1 for 24 h decreased in ~ 55% DAPI diffusion in Hela-Cx43GFP/ACE2mCherry cells compared to control conditions (Fig. 4A and B). These results suggest that spike S1 oppositely regulates the activity of Cx43 hemichannels and gap junction channels.

Fig. 4
figure 4

Spike S1 decreases gap junction channel activity. (A) Representative fluorescence micrographs of SL/DT with DAPI by HeLa-Cx43GFP/ACE2mCherry under control conditions (top pannel) or after treatment with 50 pM spike S1 for 24 h (bottom pannel). (B) Averaged data normalized to control (dashed line) of SL/DT with DAPI by HeLa-Cx43GFP/ACE2mCherry treated with 50 pM spike S1 for 24 h. *p < 0.05, the effect of spike S1 compared to control (two-tailed Student’s unpaired t test). Averaged data were obtained from three independent experiments with four repeats each. Scale bar = 100 μm

Full size image

Spike S1 elevates the release of ATP and ATP-dependent Ca2+ dynamics via Cx43 hemichannels: potentiation by ACE2

Extracellular ATP plays a crucial role as a signaling molecule during various inflammatory conditions, attracting both innate and acquired immune systems to the site of injury or infection [71]. Cx43 hemichannels are permeable to ATP, as demonstrated by its bioluminescence imaging combined with single-channel recordings [68]. Relevantly, the release of ATP through Cx43 hemichannels has been shown to trigger immune cell activation and inflammation, contributing to the inflammatory response [72,73,74]. In this context and given that SARS-CoV-2 induces the release of ATP [65, 75], we examined whether spike S1 could affect the release of this messenger in our experimental setup. Treatment with 50 pM spike S1for 24 h did not modify the release of ATP in HeLa-Cx43GFP cells (Fig. 5A). Similar findings were observed in HeLa-parental or HeLa-ACE2mCherry cells stimulated with spike S1 (Fig. 5A). Interestingly, HeLa-Cx43GFP/ACE2mCherry cells treated with 50 pM spike S1 for 24 h showed a significant 2-fold increase in the release of ATP compared to control conditions (Fig. 5A). This response was inhibited entirely to control values with the specific Cx43 hemichannel blocker TAT-L2 (Fig. 5B). These results suggest that spike S1 induces the release of ATP by a mechanism implicating the activation of Cx43 hemichannels and ACE2.

Fig. 5
figure 5

Spike S1 elevates the release of ATP via Cx43 hemichannels. (A) Averaged data of ATP release normalized with the control condition (dashed line) by HeLa-parental, HeLa-Cx43GFP, HeLa-Cx43GFP/ACE2mCherry , or HeLa-ACE2mCherry cells, treated for 24 h with 50 pM spike S1. *p < 0.05, the effect of spike S1 compared to control (one-way ANOVA followed by Tukey’s post-hoc test). (B) Averaged data of ATP release normalized with the control condition (dashed line) by HeLa-Cx43GFP/ACE2mCherry cells stimulated with 50 pM spike S1 for 24 h alone or plus 200 µM TAT-L2. *p < 0.05, the effect of spike S1 compared to control; #p < 0.05; effect of spike S1 vs. blockers 1 (one-way ANOVA followed by Tukey’s post-hoc test). Data were obtained from at least three independent experiments with four repeats each

Full size image

The activity of Cx43 hemichannels increases in response to moderate increases (> 500 nM) in [Ca2+]i [76]. More relevantly, these channels can potentially allow extracellular Ca2+ to flow into cells, thereby playing a crucial role in maintaining [Ca2+]i homeostasis [77, 78]. A recent report indicated that spike S1 elicits Ca2+ influx in pancreatic stellate cells and macrophages [79]. In this scenario, we tested whether spike S1 could alter [Ca2+]i levels in our system (Fig. 6A-D). Fura-2 ratio (340/380) time-lapse recordings showed that basal [Ca2+]i in all HeLa transfectants remained unchanged upon treatment with 50 pM spike S1 for 24 h (Fig. 6E). Although spike S1 did not affect the basal [Ca2+]i, it may still impact [Ca2+]i dynamics triggered by paracrine molecules. Because we found that spike S1 triggers the release of ATP via Cx43 hemichannels, we investigated the effect of spike S1 on [Ca2+]i responses elicited by this paracrine messenger. When HeLa parental or HeLa-ACE2mCherry cells were acutely stimulated with 10 µM ATP, a rapid [Ca2+]i peak was observed, followed by a quick return to basal levels (Fig. 6A and D). Spike S1 did not modify the ATP-mediated [Ca2+]i responses in these cells (Fig. 6A and D-H). In contrast, Hela-Cx43GFP or HeLa-Cx43GFP/ACE2mCherry cells showed a rapid [Ca2+]i peak upon ATP stimulation with slow returning kinetics to basal values (Fig. 6B and C). Notably, spike S1 increased the peak amplitude and integrated [Ca2+]i signal triggered by ATP in Hela-Cx43GFP cells (Fig. 6B and F-H). These ATP-mediated [Ca2+]i responses were potentiated in HeLa-Cx43GFP/ACE2mCherry cells treated with spike S1 (Fig. 6C and F-H). Altogether these findings suggest that the opening of Cx43 hemichannels contributes to the spike S1-induced augment in ATP-mediated [Ca2+]i dynamics, this response being potentiated with the co-presence of ACE2.

Fig. 6
figure 6

Spike S1 augments ATP-dependent Ca2+ dynamics via Cx43 hemichannels. (A-D) Representative plots of relative changes in Ca2+ signal over time induced by 100 µM ATP (light blue background) in HeLa-parental (A), HeLa-Cx43GFP (B), HeLa-Cx43GFP/ACE2mCherry (C) or HeLa-ACE2mCherry (D) cells under control conditions (white circles) or treated with 50 pM spike S1 for 24 h (red circles). (E-H) Averaged data normalized to the control conditions (dashed line) of basal Ca2+ signal (E), ATP-induced peak amplitude normalized to basal Fura-2 ratio (F), integrated ATP-induced Fura-2 ratio response (G) and altered basal Fura-2 ratio (H) of HeLa-parental, HeLa-Cx43GFP, HeLa-Cx43GFP/ACE2mCherry or HeLa-ACE2mCherry treated with 50 pM spike S1 for 24 h. *p < 0.05, **p < 0.01; effect of spike S1 compared to control (one-way ANOVA followed by Tukey’s post-hoc test). Data were obtained from at least three independent experiments with two repeats each (≥ 12 cells analyzed for each repeat)

Full size image

Recent studies have reported that spike S1 induces apoptosis in various cell types [80,81,82], while prolonged activation of Cx43 hemichannels has been shown to reduce cell viability under pathological conditions [53, 83, 84]. Given this context, we investigated whether spike S1 could impact cell viability in our experimental setup. To assess this, we measured cell viability by quantifying the reduction of MTT to formazan, a process directly correlated with the number of metabolically active cells in culture. Interestingly, treatment with spike S1 for varying periods of stimulation did not result in any changes in cell viability across all HeLa cell transfectants, parental, Cx43GFP, HeLa-Cx43GFP/ACE2mCherry or ACE2mCherry (Fig. 7). These data suggest that under these conditions, spike S1 has no significant impact on cell survival.

Fig. 7
figure 7

Spike S1 has no effect on cell viability. Averaged data normalized to the control conditions (dashed line) of MTT cell viability by HeLa-parental, HeLa-Cx43GFP, HeLa-Cx43GFP/ACE2mCherry or HeLa-ACE2mCherry treated with 50 pM spike S1 for 24, 48, 72 or 96 h. Data were obtained from at least three independent experiments with two repeats each

Full size image

Discussion

This study reveals for the first time that spike S1 enhances the activity of Cx43 hemichannels. The presence of the SARS-CoV-2 binding receptor ACE2 potentiated this effect. Interestingly, the spike S1-induced opening of Cx43 hemichannels leads to significant changes in [Ca2+]i dynamics and ATP release. By performing time-lapse recordings, we observed that spike S1 time and dose-dependently increased the uptake of Etd in HeLa-Cx43GFP but not HeLa-parental cells. To test whether ACE2 could contribute to the spike S1-induced activity of Cx43 hemichannels, we further performed time-lapse recordings of DAPI uptake in HeLa-Cx43GFP/ACE2mCherry cells. The expression of ACE2mCherry did not alter the functional opening of Cx43 hemichannels, as DCFS media triggered similar increments in DAPI uptake in HeLa-Cx43GFP and HeLa-Cx43GFP/ACE2mCherry cells. As expected, no changes in DAPI uptake were detected in HeLa-parental or HeLa-ACE2mCherry cells. Remarkably, DAPI uptake evoked by spike S1 in HeLa-Cx43GFP cells was potentiated when similar experiments were conducted on HeLa-Cx43GFP/ACE2mCherry cells.

The involvement of Cx43 hemichannels in spike S1-induced DAPI uptake in HeLa-Cx43GFP/ACE2mCherry cells was confirmed using selective mimetic peptides (gap19 and TAT-L2) to antagonize Cx43 hemichannels. The latter was consistent with the fact that blocking Panx1 hemichannels with 10panx1 did not elicit any inhibitory effect. Electrophysiological experiments in whole-cell configuration further supported these findings, as both La3+ and high extracellular Ca2+ completely suppressed the Cx43 hemichannel currents produced by spike S1. These results align with previous studies demonstrating that viruses or their viral proteins trigger the activation of Cx43 hemichannels [49, 50]. Numerous lines of evidence indicate that during inflammatory scenarios, hemichannels and gap junction channels in exhibit contrasting activation patterns [60]. Supporting this inverse regulation, we observed that the opening of Cx43 hemichannels induced by spike S1 coincided with a reduction in cell-cell coupling in HeLa Cx43GFP/ACE2mCherry cells, as evidenced by the intercellular diffusion of DAPI.

Previous research has demonstrated that SARS-CoV-2 induces the release of various “danger” signals, including ATP [65, 75]. The release of ATP occurs through Cx43 hemichannels [68], which could amplify cell damage by impairing [Ca2+]i dynamics and [Ca2+]i homeostasis [42, 85,86,87]. Here, we found that activation of Cx43 hemichannels and ACE2 expression were crucial for the spike S1-induced release of ATP. These findings are consistent with previous studies highlighting the release of ATP via Cx43 hemichannels in cells treated with viruses or their viral proteins such as HIV and gp120 [49, 50]. P2Y receptor-dependent release of Ca2+ from internal stores and extracellular Ca2+ influx via P2X receptors are characteristic cellular responses to ATP [88]. We found that while spike S1 did not affect basal levels of [Ca2+]i, it significantly increased ATP-induced [Ca2+]i responses, including signal amplitude, the integrated area under the curve, and sustained signal. Cx43 hemichannels were crucial for these responses as they only occurred on Cx43 HeLa transfectants but not parental HeLa cells. More relevantly, the expression of both Cx43 and ACE2 in HeLa cells largely potentiated this phenomenon. Furthermore, our findings indicate that spike S1 does not have an impact on cell viability. This suggests that spike S1-mediated opening of Cx43 hemichannels and further release of ATP primarily impair cell function rather than directly causing cell death.

What are the mechanisms behind the activation of Cx43 hemichannels evoked by spike S1? They could be multiple. For example, acute stimulation with spike S1 leads to an ACE2-dependent persistent increase in [Ca2+]i baseline in pulmonary endothelial cells [89] and spontaneous [Ca2+]i transients in pancreatic cells [79]. Since a moderate rise in [Ca2+]i (< 500 nM) significantly enhances Cx43 hemichannel activity [76], the spike S1-mediated augment of Cx43 hemichannel activity could rely on [Ca2+]i. The S-nitrosylation of Cx43 hemichannels by the action of nitric oxide (NO) could be another possibility to explain the opening of these channels. Indeed, the spike protein S1 has been shown to enhance the release of NO in microglia [90]. Additionally, it triggers the production of IL-1β and TNF, along with the activation of p38 MAP kinase via Toll-like receptor 4 [90]. Importantly, these factors are well-documented for their role in promoting the opening of Cx43 hemichannels during pro-inflammatory conditions [91, 92]. In this context, we speculate that the Cx43 hemichannel-mediated release of ATP and/or its derivatives (e.g., ADP) may propagate the signaling effects of spike S1 to neighboring cells, leading to [Ca2+]i responses that can impair cell function. More relevantly, given that Cx43 hemichannels are permeable to Ca2+ [78] they could contribute to perpetuating the propagation of ATP-mediated signaling.

Could the spike S1-induced activation of Cx43 hemichannels potentially account for the side effects on SARS-CoV-2 vaccines? The S protein-encoding mRNA vaccines targeting SARS-CoV-2 trigger enduring and robust systemic immunity, and thus, their contribution to stemming the COVID-19 pandemic and safeguarding countless lives is indisputable. While uncommon, adverse effects of mRNA vaccines encompass acute myocardial infarction, Bell’s palsy, cerebral venous sinus thrombosis, Guillain–Barré syndrome, myocarditis/pericarditis, and severe clinical conditions [93, 94]. In addition to the potential allergic reactions of lipid nanoparticles [95] and packaged mRNA [96], adverse effects resulting from vaccination may be linked to distinctive properties of the S protein itself, either due to molecular mimicry with human proteins or its role as an ACE2 ligand. With this in mind, it is possible to speculate that the opening of Cx43 hemichannels and their downstream signaling could account for the adverse effect in cellular function evoked by spike S1 acting on ACE2 receptors. Further research is required to clarify the potential involvement of Cx43 hemichannels in this context.

Conclusions

Our findings indicate that upon SARS-CoV-2 infection, activation of Cx43 hemichannels by spike S1 occurs rapidly. This activation leads to an increase in the release of ATP and enhances ATP-mediated [Ca2+]i dynamics. We speculate that this response may be amplified in cells expressing high levels of ACE2, particularly those found in the cardiorespiratory system [97]. Our study suggests a novel mechanism through which SARS-CoV-2 disrupts cell function. This mechanism could involve the successive release of ATP and Cx43 hemichannel-mediated [Ca2+]i signaling via spike protein S1. Understanding the molecular mechanisms underlying these effects could unveil potential pharmacological targets for developing therapies to counteract SARS-CoV-2 infection and related diseases, including Long-COVID.

Methods

Reagents and antibodies

HEPES, ATP, bzATP, NaCl, KCl, CaCl2, MgCl2 and glucose were obtained from MERCK (Darmstadt, Germany). Penicillin (10000U) and streptomycin (10 mg/mL) were purchased from Sigma-Aldrich (St. Louis, MO, USA). Fetal bovine serum (FBS) was purchased from Hyclone (Logan, UT, USA), whereas Trypsin 10X, Hank’s solution, ATP determination kit, Fura-2AM, Dulbecco’s Modified Eagle Medium (DMEM), Phosphate-Buffered Saline (PBS) and Etd bromide (10 mg/mL) were purchased from Thermo Fisher Scientific (Waltham, MA, USA). The Recombinant human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (ab273068, Wuhan-Hu-1 variant: MN908947) and 4′,6-diamidino-2-phenylindole (DAPI) were obtained from Abcam (Cambridge, UK). The mimetic peptides gap19 (KQIEIKKFK, intracellular loop domain of Cx43), TAT-L2 (YGRKKRRQRRR-DGANVDMHLKQIEIKKFKYGIEEHGK, intracellular loop domain of Cx43) and 10panx1 (WRQAAFVDSY, first extracellular loop domain of Panx1) were obtained from Genscript (New Jersey, USA).

Cell cultures

HeLa cells (ATCC, Rockville, MD, USA) were cultured in DMEM with 10% FBS, 100 U/ml penicillin and 100 µg/ml streptomycin sulfate (Nunc, Roskilde, Denmark). Attached cells were dissociated for sub-culturing with 0.05% trypsin-EDTA (ThermoFisher Scientific, Massachusetts, USA). For single transfection, HeLa cells were seeded in 35 mm plates and grown at ~ 60% confluence. Then, they were transfected with 1 µg of pRP (Exp-mCherry/Bsd-CMV/hACE2 vector (NM-021804.3, VectorBuilder Inc, Chicago, IL, USA), or pCMV6-AC-Cx43GFP (Origene, Origene, Rockville, MD, USA). Optimem medium (ThermoFisher Scientific, Waltham, MA, USA), plus Lipofectamine 2000 and 1 µg of the plasmids were mixed. Then, the culture medium was replaced with Optimem, and the transfection mixture was added. After 4 h, the cells were incubated in DMEM with 10% FBS at 37 °C, in 5% CO2, and 48 h later, they were evaluated for expression in an epifluorescence microscope. Selection started by adding the antibiotic G418 in the case of HeLa expressing Cx43GFP or blasticidin in the case of HeLa cells expressing ACE2 to the culture media three times per week for two weeks. Parental or ACE2 HeLa cells do not show levels of Cx43 (Supplementary Fig. 1). In the case of the double transfected cells, selected HeLa Cx43GFP cells were transfected with ACE2 following the same protocol described above, but in this case, cells were maintained with G418 and Bsd for two weeks or until a stable clone expressing GFP and mCherry were observed under the microscope. In our hands, after selection, ~ 70% of the cells were expressing both proteins.

Cell treatments

Depending on the experiment and cell line type, cells were treated with 10, 50, 100 or 1000 pM Spike S1 at different periods of exposure: acutely or 1, 24, 48, or 72 h. To obtain conditioned media from cells, they were seeded (2 × 106 cells in 35 mm dishes) in DMEM containing 10% FBS and treated with 50 pM spike S1 for 24 h. Supernatants were collected, filtered (0.22 μm), and stored at -20 °C before being used for experiments. Mimetic peptides against Cx43 (100 µM gap19 or TAT-L2) or Panx1 hemichannels (100 µM 10panx1) were used in cell cultures 15 min before and co-applied during dye uptake and time-lapse recordings (see below). The effectiveness of 10panx1 mimetic peptide was confirmed by its inhibitory effect on BzATP-induced Etd uptake in cultured astrocytes (Supplementary Fig. 2), a well-known stimulus that activates Panx1 hemichannels in these cells.

Dye uptake and time-lapse fluorescence imaging

To characterize the functional state of hemichannels, dye uptake experiments using Etd and DAPI were performed. In the case of Etd uptake, cells were bathed with recording solution (in mM): 148 NaCl, 5 KCl, 1.8 CaCl2, 1 MgCl2, 5 glucose, and 5 HEPES, pH 7.4, containing 5 µM Etd and imaged on an Olympus BX 51W1I upright microscope. Etd fluorescence was captured every 30 s for 8 min by a Retiga 1300I fast-cooling monochrome digital monochrome camera (12-bit; Q Imaging, Burnaby, BC, Canada) controlled by Metafluor imaging software (Universal Imaging, Downingtown, PA, USA). In the case of DAPI uptake, cells were bathed with recording solution (in mM): 140 NaCl, 4 KCl, 2 CaCl2, 1 MgCl2, 5 glucose, and 10 HEPES, pH = 7.4 containing 10 µM DAPI and imaged on an inverted microscope (Eclipse Ti-U, Nikon). In some experiments, cells were exposed to a divalent cation-free solution (DCFS), which was comprised of (in mM): 140 NaCl, 4 KCl, 5 mM EGTA (an extracellular Ca2+ chelator), 5 glucose, and 10 HEPES, pH = 7.4. DAPI fluorescence intensity was captured every 20 s during a 20 min period at room temperature, using a light LED-based source and adequate filters (Ex/Em) for GFP, mCherry, and DAPI. NIS element advanced research software (version 4.0, Nikon) was used for data acquisition and image analysis. Fluorescence intensity was recorded in 15–20 cells with ImageJ software and calculated with the following formula: corrected total cell fluorescence = integrated density - ([Selected cell area] × [Mean fluorescence of background readings]). The average slope of the fluorescence ratio during a given time interval (ΔF/ΔT) was calculated using Excel and GraphPad Prism software, where it will be expressed as the Etd uptake rate (AU/min).

Electrophysiology

HeLa cells were grown in a 60 mm plastic dish until 60–70% confluence. The day of experimentation, cells were washed with recording solution twice. Then, 1 ml of 0.05% trypsin-EDTA (ThermoFisher Scientific, Massachusetts, USA) was added, and cells were placed at 37 °C for approximately 1 min or until cells looked partially detached. At this point, cells were gently detached using a 1 ml micropipette. Cells were placed in a 15 plastic tube containing 5 ml DMEM plus 10% FBS and centrifuged for 3 min at 1300 rpm. Then, the supernatant was discharged, and cells were resuspended in 6 ml of recording media and centrifuged at 1300 rpm for 3 min. This step was repeated twice. Finally, cells were resuspended in 200 ml recording solution and placed in a 1.5 ml Eppendorf tube. Following a recovery period (30 min at room temperature), cells were gently resuspended and 8 µl of cell suspension was placed in the Patchliner (NPC-16 Patchliner system, Nanion Technologies GmbH, Germany). Patch-control HT software (HEKA Elektronik, Germany) was used to control the pressure necessary to establish the whole-cell configuration. Hemichannel currents were recorded at room temperature (22–23 °C), using an internal solution (in mM): 10 NaF, 110 CsF, 20 CsCl, 2 EGTA, and 10 HEPES, pH 7.4 (adjusted with CsOH) and external solution equal to recording solution described in the previous section. Following cell contact with the 3–5 MΩ planar electrode, 30 µl of seal enhancer solution (in mM: 80 NaCl, 3 KCl, 35 CaCl2, 10 HEPES/NaOH pH 7.4) were added to the external solution to promote giga-ohm seal formation. After establishing the whole-cell configuration, the seal enhancer solution was replaced with two washes with a recording solution. Cells were allowed to stabilize for 2 min after starting whole-cell recordings. Patchmaster software (HEKA) was used to automatically compensate for whole-cell capacitance and series resistance, and perform voltage-clamp protocols. Igor Pro 9 was used to analyze the data and create the figures.

Scrape loading/dye transfer assay

Gap junction permeability was evaluated at room temperature using the scrape-loading/dye transfer (SL/DT) technique. Briefly, cells cultures were washed for 10 min in HEPES-buffered salt solution containing the following (in mM): 140 NaCl, 5.5 KCl, 1.8 CaCl2, 1 MgCl2, 5 glucose, 10 HEPES, pH 7.4 followed by washing in a Ca2+-free HEPES solution for 1 min. Then, a razor blade cut was made in the monolayer in a HEPES-buffered salt solution with normal Ca2+ concentration containing 10 µM DAPI. After 3 min, DAPI was washed out several times with HEPES-buffered salt solution. At 15 min after scraping, fluorescent images were captured using a a Zeiss Axio Observer D.1 Inverted Microscope with a Solid-State Colibri 7 LED illuminator and with a 20x objective. Changes were monitored using an AxioCam MRm monochrome digital camera R3.0 (Carl Zeiss AG, Zeiss, Oberkochen, Germany), and Software ZEN Pro (Zen 2.3 [blue edition], Carl Zeiss AG, Oberkochen, Germany) for image acquisition and analysis. For each trial, data were quantified by measuring fluorescence areas in three representative fields. Quantification of changes in gap junctional communication induced by different treatments was performed by measuring the fluorescence area, expressed as arbitrary units (AU).

[Ca2+]i cell imaging

Cells plated on glass coverslips were loaded with 5 µM Fura-2-AM in DMEM without serum at 37 °C for 45 min and then washed three times in recording solution (in mM): 140 NaCl, 4 KCl, 2 CaCl2, 1 MgCl2, 5 glucose, and 10 HEPES, pH = 7.4, followed by de-esterification at 37 °C for 15 min. The experimental protocol for Ca2+ signal imaging involved data acquisition every 10 s for 5 min (emission at 510 and 515 nm, respectively) at 340/380-nm excitation wavelengths (Xenon lamp) using an inverted microscope (Eclipse Ti-U, Nikon). NIS element advanced research software (version 4.0, Nikon) was used for data acquisition and image analysis. Fluorescence intensity recorded in 15 cells involved the determination of pixels assigned to each cell. The average pixel value allocated to each cell was obtained with excitation at each wavelength and corrected for background. The Fura-2 ratio was obtained after dividing the 340-nm by the 380-nm fluorescence image on a pixel-by-pixel base (R = F340 nm/F380 nm).

Measurement of ATP

The extracellular amount of ATP was measured using the ATP determination kit according to the protocol provided by its supplier Invitrogen (ATP Determination Kit, A22066). Using the conditioned medium of the different treated cell lines and applying the kit that includes D-Luciferin and recombinant firefly luciferase, the luminescence produced by luciferin upon binding with ATP present in the conditioned medium was measured using a Tecan Infinite® M200 PRO plate reader spectrometer (Männedorf, Switzerland) and the i-control™ software.

Assessment of cell viability

Cells seeded at 5 × 104 cells/well in 96-well plate were treated or not (control) with spike S1 for 24, 48, 72 or 96 h. 10 µl of aqueous MTT solution (4 mg/ml) was then added to each well (100 µl), and the mixture was incubated at 37 °C for 3 h. The MTT solution was carefully decanted off, and formazan was extracted from the cells with 100 µl of a 4:1 DMSO–EtOH mixture in each well. Color was measured with a 96-well ELISA plate reader at 550 nm, with the reference filter set to 620 nm. All MTT assays were repeated three times.

Western blot

Hela cells were lysed in 200 µl of RIPA lysis buffer supplemented with complete protease inhibitors (Roche) and sonicated on ice. Protein concentration was quantified using the Qubit Protein assay kit (Life Technologies) and the Qubit 3.0 Fluorometer (ThermoFisher Scientific). A total of 50 µg of denatured proteins in loading buffer were prepared by heating at 95 °C for 3 min. At this point, proteins were separated by 10% SDS-PAGE gel electrophoresis or stored at -80 °C. After the electrophoresis, proteins were transferred to 0.45 nm nitrocellulose membranes (Bio-Rad) using the Mini-PROTEAN Tetra System (Bio-Rad). Then, membranes were blocked with 5% milk in 0.05% TBST for at least 30 min at room temperature. After that, membranes were incubated with primary antibodies diluted in a blocking solution overnight. In the next day, membranes were washed three times with 0.05% TBST, following the incubation with secondary antibodies in a blocking solution for 2 h at room temperature. To finish, membranes were washed three times with 0.05% TBST and exposed to Luminata Forte HRP substrate (Millipore) and visualized with the C-Digit Chemiluminescence Western Blot Scanner system ECL (LI-COR, Inc, Lincoln, USA).

Data analysis and statistics

Results were expressed as mean ± standard error of the mean (SEM); n refers to the number of independent experiments performed. Statistical analysis was performed using GraphPad Prism (version 9, GraphPad Software, La Jolla, CA, USA). Normality and equal variances were assessed by the Shapiro-Wilk normality test and Brown-Forsythe test, respectively. Depending on the nature of the data, they were analyzed with parametric or nonparametric tests. When the data were normal, without unequal variance and non-heteroscedastic, a t-test was used to compare two groups and in case of multiple comparisons, one or two-way analysis of variance (ANOVA) was used followed, in the case of significance, of a Tukey’s post-hoc test. When the data were heterocedastic as well as non-normal and with unequal variation, nonparametric tests were used, such as Kruskal-Wallis test followed, in the case of the significance, by a Dunn’s post-hoc test. Details of the statistical results, together with the n and number of replicates, are included in figure legends. A probability of p < 0.05 was considered statistically significant.

Data Availability

The datasets used and/or analyzed during the current study are available from the corresponding author upon reasonable request.

Abbreviations

ACE2:

Angiotensin-converting enzyme 2

COVID-19:

Coronavirus disease 2019

Cx43:

Connexin 43

DCFS:

Divalent cation-free solution

DMEM:

Dulbecco’s Modified Eagle Medium

Etd:

Ethidium

FBS:

Fetal bovine serum

HIV:

Human immunodeficiency virus

Panx1:

Pannexin-1

PBS:

Phosphate-Buffered Saline

SARS-CoV-2:

Severe acute respiratory syndrome coronavirus 2

Spike S1:

Spike protein S1

References

  1. Zhou P, Yang XL, Wang XG, Hu B, Zhang L, Zhang W, et al. A Pneumonia outbreak associated with a new coronavirus of probable bat origin. Nature. 2020;579(7798):270–3.

    CAS  PubMed  PubMed Central  Google Scholar 

  2. Merad M, Blish CA, Sallusto F, Iwasaki A. The immunology and immunopathology of COVID-19. Science. 2022;375(6585):1122–7.

    CAS  PubMed  Google Scholar 

  3. Henry BM, Lippi G. Poor survival with extracorporeal membrane oxygenation in acute respiratory distress syndrome (ARDS) due to coronavirus Disease 2019 (COVID-19): pooled analysis of early reports. J Crit Care. 2020;58:27–8.

    CAS  PubMed  PubMed Central  Google Scholar 

  4. Collaborators C-EM. Estimating excess mortality due to the COVID-19 pandemic: a systematic analysis of COVID-19-related mortality, 2020-21. Lancet. 2022;399(10334):1513–36.

    Google Scholar 

  5. Soriano JB, Murthy S, Marshall JC, Relan P, Diaz JV, Definition WCC. A clinical case definition of post-COVID-19 condition by a Delphi consensus. Lancet Infect Dis. 2022;22(4):E102–E7.

    CAS  PubMed  Google Scholar 

  6. Nalbandian A, Sehgal K, Gupta A, Madhavan MV, McGroder C, Stevens JS, et al. Post-acute COVID-19 syndrome. Nat Med. 2021;27(4):601–15.

    CAS  PubMed  PubMed Central  Google Scholar 

  7. Mehandru S, Merad M. Pathological sequelae of long-haul COVID. Nat Immunol. 2022;23(2):194–202.

    CAS  PubMed  PubMed Central  Google Scholar 

  8. Townsend L, Dyer AH, Jones K, Dunne J, Mooney A, Gaffney F, et al. Persistent fatigue following SARS-CoV-2 Infection is common and Independent of severity of initial Infection. PLoS ONE. 2020;15(11):e0240784.

    CAS  PubMed  PubMed Central  Google Scholar 

  9. Files JK, Sarkar S, Fram TR, Boppana S, Sterrett S, Qin K et al. Duration of post-COVID-19 symptoms is associated with sustained SARS-CoV-2-specific immune responses. JCI Insight. 2021;6(15).

  10. Phillips S, Williams MA. Confronting our Next National Health Disaster - Long-Haul Covid. N Engl J Med. 2021;385(7):577–9.

    CAS  PubMed  Google Scholar 

  11. Priya SP, Sunil PM, Varma S, Brigi C, Isnadi M, Jayalal JA, et al. Direct, indirect, post-infection damages induced by coronavirus in the human body: an overview. Virusdisease. 2022;33(4):429–44.

    CAS  PubMed  PubMed Central  Google Scholar 

  12. Letarov AV, Babenko VV, Kulikov EE. Free SARS-CoV-2 spike protein S1 particles may play a role in the pathogenesis of COVID-19 Infection. Biochem (Mosc). 2021;86(3):257–61.

    CAS  Google Scholar 

  13. Petrovszki D, Walter FR, Vigh JP, Kocsis A, Valkai S, Deli MA et al. Penetration of the SARS-CoV-2 spike protein across the blood-brain barrier, as revealed by a combination of a human cell culture Model System and Optical Biosensing. Biomedicines. 2022;10(1).

  14. Oh J, Cho WH, Barcelon E, Kim KH, Hong J, Lee SJ. SARS-CoV-2 spike protein induces cognitive deficit and anxiety-like behavior in mouse via non-cell autonomous hippocampal neuronal death. Sci Rep. 2022;12(1):5496.

    CAS  PubMed  PubMed Central  Google Scholar 

  15. Theoharides TC. Could SARS-CoV-2 spike protein be responsible for Long-COVID syndrome? Mol Neurobiol. 2022;59(3):1850–61.

    CAS  PubMed  PubMed Central  Google Scholar 

  16. Hoffmann M, Kleine-Weber H, Schroeder S, Kruger N, Herrler T, Erichsen S, et al. SARS-CoV-2 cell entry depends on ACE2 and TMPRSS2 and is blocked by a clinically proven protease inhibitor. Cell. 2020;181(2):271–80. e8.

    CAS  PubMed Central  Google Scholar 

  17. Bollavaram K, Leeman TH, Lee MW, Kulkarni A, Upshaw SG, Yang J et al. Multiple sites on SARS-CoV-2 spike protein are susceptible to proteolysis by cathepsins B, K, L, S, and V. Protein Sci. 2021;30(6):1131-43.

  18. Rhea EM, Logsdon AF, Hansen KM, Williams LM, Reed MJ, Baumann KK, et al. The S1 protein of SARS-CoV-2 crosses the blood-brain barrier in mice. Nat Neurosci. 2021;24(3):368–78.

    CAS  PubMed  Google Scholar 

  19. Ogata AF, Maley AM, Wu C, Gilboa T, Norman M, Lazarovits R, et al. Ultra-sensitive serial profiling of SARS-CoV-2 antigens and antibodies in plasma to Understand Disease Progression in COVID-19 patients with severe Disease. Clin Chem. 2020;66(12):1562–72.

    PubMed  PubMed Central  Google Scholar 

  20. Schultheiss C, Willscher E, Paschold L, Gottschick C, Klee B, Bosurgi L, et al. Liquid biomarkers of macrophage dysregulation and circulating spike protein illustrate the biological heterogeneity in patients with post-acute sequelae of COVID-19. J Med Virol. 2023;95(1):e28364.

    CAS  PubMed  Google Scholar 

  21. Lei Y, Zhang J, Schiavon CR, He M, Chen L, Shen H, et al. SARS-CoV-2 spike protein impairs endothelial function via downregulation of ACE 2. Circ Res. 2021;128(9):1323–6.

    CAS  PubMed  PubMed Central  Google Scholar 

  22. Nuovo GJ, Magro C, Shaffer T, Awad H, Suster D, Mikhail S, et al. Endothelial cell damage is the central part of COVID-19 and a mouse model induced by injection of the S1 subunit of the spike protein. Ann Diagn Pathol. 2021;51:151682.

    PubMed  Google Scholar 

  23. Perico L, Morigi M, Galbusera M, Pezzotta A, Gastoldi S, Imberti B, et al. SARS-CoV-2 spike protein 1 activates microvascular endothelial cells and complement system leading to platelet aggregation. Front Immunol. 2022;13:827146.

    CAS  PubMed  PubMed Central  Google Scholar 

  24. Avolio E, Carrabba M, Milligan R, Kavanagh Williamson M, Beltrami AP, Gupta K, et al. The SARS-CoV-2 spike protein disrupts human cardiac pericytes function through CD147 receptor-mediated signalling: a potential non-infective mechanism of COVID-19 microvascular Disease. Clin Sci (Lond). 2021;135(24):2667–89.

    CAS  PubMed  Google Scholar 

  25. Buzhdygan TP, DeOre BJ, Baldwin-Leclair A, Bullock TA, McGary HM, Khan JA, et al. The SARS-CoV-2 spike protein alters barrier function in 2D static and 3D microfluidic in-vitro models of the human blood-brain barrier. Neurobiol Dis. 2020;146:105131.

    CAS  PubMed  PubMed Central  Google Scholar 

  26. Lucero CM, Prieto-Villalobos J, Marambio-Ruiz L, Balmazabal J, Alvear TF, Vega M et al. Hypertensive Nephropathy: unveiling the possible involvement of Hemichannels and Pannexons. Int J Mol Sci. 2022;23(24).

  27. Peng B, Xu C, Wang S, Zhang Y, Li W. The role of Connexin Hemichannels in Inflammatory Diseases. Biology (Basel). 2022;11(2).

  28. Gonzalez-Jamett A, Vasquez W, Cifuentes-Riveros G, Martinez-Pando R, Saez JC, Cardenas AM. Oxidative stress, inflammation and Connexin Hemichannels in muscular dystrophies. Biomedicines. 2022;10(2).

  29. Mugisho OO, Green CR. The NLRP3 inflammasome in age-related eye Disease: evidence-based connexin hemichannel therapeutics. Exp Eye Res. 2022;215:108911.

    CAS  PubMed  Google Scholar 

  30. Retamal MA, Fernandez-Olivares A, Stehberg J. Over-activated hemichannels: a possible therapeutic target for human Diseases. Biochim Biophys Acta Mol Basis Dis. 2021;1867(11):166232.

    CAS  PubMed  Google Scholar 

  31. Xing L, Yang T, Cui S, Chen G. Connexin Hemichannels in astrocytes: role in CNS disorders. Front Mol Neurosci. 2019;12:23.

    CAS  PubMed  PubMed Central  Google Scholar 

  32. Syrjanen J, Michalski K, Kawate T, Furukawa H. On the molecular nature of large-pore channels. J Mol Biol. 2021;433(17):166994.

    CAS  PubMed  PubMed Central  Google Scholar 

  33. Saez JC, Leybaert L. Hunting for connexin hemichannels. FEBS Lett. 2014;588(8):1205–11.

    CAS  PubMed  Google Scholar 

  34. Plotkin LI. Connexin 43 hemichannels and intracellular signaling in bone cells. Front Physiol. 2014;5:131.

    PubMed  PubMed Central  Google Scholar 

  35. D’Hondt C, Iyyathurai J, Himpens B, Leybaert L, Bultynck G. Cx43-hemichannel function and regulation in physiology and pathophysiology: insights from the bovine corneal endothelial cell system and beyond. Front Physiol. 2014;5:348.

    PubMed  PubMed Central  Google Scholar 

  36. Retamal MA, Riquelme MA, Stehberg J, Alcayaga J. Connexin43 hemichannels in Satellite glial cells, can they influence sensory neuron activity? Front Mol Neurosci. 2017;10:374.

    PubMed  PubMed Central  Google Scholar 

  37. Beyer EC, Berthoud VM. Connexin hemichannels in the lens. Front Physiol. 2014;5:20.

    PubMed  PubMed Central  Google Scholar 

  38. Stout CE, Costantin JL, Naus CC, Charles AC. Intercellular calcium signaling in astrocytes via ATP release through connexin hemichannels. J Biol Chem. 2002;277(12):10482–8.

    CAS  PubMed  Google Scholar 

  39. Turovsky EA, Varlamova EG, Turovskaya MV. Activation of Cx43 hemichannels induces the generation of ca(2+) oscillations in White adipocytes and Stimulates Lipolysis. Int J Mol Sci. 2021;22(15).

  40. Khalil AA, Ilina O, Vasaturo A, Venhuizen JH, Vullings M, Venhuizen V et al. Collective invasion induced by an autocrine purinergic loop through connexin-43 hemichannels. J Cell Biol. 2020;219(10).

  41. Recabal A, Fernandez P, Lopez S, Barahona MJ, Ordenes P, Palma A, et al. The FGF2-induced tanycyte proliferation involves a connexin 43 hemichannel/purinergic-dependent pathway. J Neurochem. 2021;156(2):182–99.

    CAS  PubMed  Google Scholar 

  42. De Smet MA, Lissoni A, Nezlobinsky T, Wang N, Dries E, Perez-Hernandez M et al. Cx43 hemichannel microdomain signaling at the intercalated disc enhances cardiac excitability. J Clin Invest. 2021;131(7).

  43. Chever O, Lee CY, Rouach N. Astroglial connexin43 hemichannels tune basal excitatory synaptic transmission. J Neurosci. 2014;34(34):11228–32.

    PubMed  PubMed Central  Google Scholar 

  44. Meunier C, Wang N, Yi C, Dallerac G, Ezan P, Koulakoff A, et al. Contribution of Astroglial Cx43 hemichannels to the modulation of glutamatergic currents by D-Serine in the mouse Prefrontal Cortex. J Neurosci. 2017;37(37):9064–75.

    CAS  PubMed  PubMed Central  Google Scholar 

  45. Stehberg J, Moraga-Amaro R, Salazar C, Becerra A, Echeverria C, Orellana JA, et al. Release of gliotransmitters through astroglial connexin 43 hemichannels is necessary for fear memory consolidation in the basolateral amygdala. FASEB J. 2012;26(9):3649–57.

    CAS  PubMed  Google Scholar 

  46. Walrave L, Vinken M, Albertini G, De Bundel D, Leybaert L, Smolders IJ. Inhibition of Connexin43 hemichannels impairs spatial short-term memory without affecting spatial Working Memory. Front Cell Neurosci. 2016;10:288.

    PubMed  PubMed Central  Google Scholar 

  47. Linsambarth S, Carvajal FJ, Moraga-Amaro R, Mendez L, Tamburini G, Jimenez I, et al. Astroglial gliotransmitters released via Cx43 hemichannels regulate NMDAR-dependent transmission and short-term fear memory in the basolateral amygdala. FASEB J. 2022;36(2):e22134.

    CAS  PubMed  Google Scholar 

  48. Van Campenhout R, Gomes AR, De Groof TWM, Muyldermans S, Devoogdt N, Vinken M. Mechanisms underlying Connexin Hemichannel activation in Disease. Int J Mol Sci. 2021;22(7).

  49. Orellana JA, Saez JC, Bennett MV, Berman JW, Morgello S, Eugenin EA. HIV increases the release of dickkopf-1 protein from human astrocytes by a Cx43 hemichannel-dependent mechanism. J Neurochem. 2014;128(5):752–63.

    CAS  PubMed  Google Scholar 

  50. Gajardo-Gomez R, Santibanez CA, Labra VC, Gomez GI, Eugenin EA, Orellana JA. HIV gp120 protein increases the function of Connexin 43 hemichannels and Pannexin-1 channels in astrocytes: repercussions on astroglial function. Int J Mol Sci. 2020;21(7).

  51. Retamal MA, Froger N, Palacios-Prado N, Ezan P, Saez PJ, Saez JC, et al. Cx43 hemichannels and gap junction channels in astrocytes are regulated oppositely by proinflammatory cytokines released from activated microglia. J Neurosci. 2007;27(50):13781–92.

    CAS  PubMed  PubMed Central  Google Scholar 

  52. De Bock M, De Smet M, Verwaerde S, Tahiri H, Schumacher S, Van Haver V et al. Targeting gliovascular connexins prevents inflammatory blood-brain barrier leakage and astrogliosis. JCI Insight. 2022;7(16).

  53. Chavez CE, Oyarzun JE, Avendano BC, Mellado LA, Inostroza CA, Alvear TF, et al. The opening of Connexin 43 Hemichannels alters hippocampal astrocyte function and neuronal survival in prenatally LPS-Exposed adult offspring. Front Cell Neurosci. 2019;13:460.

    CAS  PubMed  PubMed Central  Google Scholar 

  54. Robertson J, Lang S, Lambert PA, Martin PE. Peptidoglycan derived from Staphylococcus epidermidis induces Connexin43 hemichannel activity with consequences on the innate immune response in endothelial cells. Biochem J. 2010;432(1):133–43.

    CAS  PubMed  Google Scholar 

  55. Johnson RG, Le HC, Evenson K, Loberg SW, Myslajek TM, Prabhu A, et al. Connexin hemichannels: methods for Dye Uptake and Leakage. J Membr Biol. 2016;249(6):713–41.

    CAS  PubMed  Google Scholar 

  56. Orellana JA, Diaz E, Schalper KA, Vargas AA, Bennett MV, Saez JC. Cation permeation through connexin 43 hemichannels is cooperative, competitive and saturable with parameters depending on the permeant species. Biochem Biophys Res Commun. 2011;409(4):603–9.

    CAS  PubMed  PubMed Central  Google Scholar 

  57. Contreras JE, Saez JC, Bukauskas FF, Bennett MV. Gating and regulation of connexin 43 (Cx43) hemichannels. Proc Natl Acad Sci U S A. 2003;100(20):11388–93.

    CAS  PubMed  PubMed Central  Google Scholar 

  58. Schalper KA, Palacios-Prado N, Orellana JA, Saez JC. Currently used methods for identification and characterization of hemichannels. Cell Commun Adhes. 2008;15(1):207–18.

    CAS  PubMed  Google Scholar 

  59. Shang J, Wan Y, Luo C, Ye G, Geng Q, Auerbach A, et al. Cell entry mechanisms of SARS-CoV-2. Proc Natl Acad Sci U S A. 2020;117(21):11727–34.

    CAS  PubMed  PubMed Central  Google Scholar 

  60. Saez JC, Vargas AA, Hernandez DE, Ortiz FC, Giaume C, Orellana JA. Permeation of molecules through Astroglial Connexin 43 Hemichannels is modulated by cytokines with parameters depending on the Permeant Species. Int J Mol Sci. 2020;21(11).

  61. Abudara V, Bechberger J, Freitas-Andrade M, De Bock M, Wang N, Bultynck G, et al. The connexin43 mimetic peptide Gap19 inhibits hemichannels without altering gap junctional communication in astrocytes. Front Cell Neurosci. 2014;8:306.

    PubMed  PubMed Central  Google Scholar 

  62. Ponsaerts R, De Vuyst E, Retamal M, D’Hondt C, Vermeire D, Wang N, et al. Intramolecular loop/tail interactions are essential for connexin 43-hemichannel activity. FASEB J. 2010;24(11):4378–95.

    CAS  PubMed  Google Scholar 

  63. Lopez X, Escamilla R, Fernandez P, Duarte Y, Gonzalez-Nilo F, Palacios-Prado N et al. Stretch-Induced activation of Pannexin 1 channels can be prevented by PKA-Dependent phosphorylation. Int J Mol Sci. 2020;21(23).

  64. Abudara V, Retamal MA, Del Rio R, Orellana JA. Synaptic functions of Hemichannels and pannexons: a double-edged Sword. Front Mol Neurosci. 2018;11:435.

    CAS  PubMed  PubMed Central  Google Scholar 

  65. Luu R, Valdebenito S, Scemes E, Cibelli A, Spray DC, Rovegno M, et al. Pannexin-1 channel opening is critical for COVID-19 pathogenesis. iScience. 2021;24(12):103478.

    CAS  PubMed  PubMed Central  Google Scholar 

  66. Pelegrin P, Surprenant A. Pannexin-1 mediates large pore formation and interleukin-1beta release by the ATP-gated P2X7 receptor. EMBO J. 2006;25(21):5071–82.

    CAS  PubMed  PubMed Central  Google Scholar 

  67. Carnarius C, Kreir M, Krick M, Methfessel C, Moehrle V, Valerius O, et al. Green fluorescent protein changes the conductance of connexin 43 (Cx43) hemichannels reconstituted in planar lipid bilayers. J Biol Chem. 2012;287(4):2877–86.

    CAS  PubMed  Google Scholar 

  68. Kang J, Kang N, Lovatt D, Torres A, Zhao Z, Lin J, et al. Connexin 43 hemichannels are permeable to ATP. J Neurosci. 2008;28(18):4702–11.

    CAS  PubMed  PubMed Central  Google Scholar 

  69. John SA, Kondo R, Wang SY, Goldhaber JI, Weiss JN. Connexin-43 hemichannels opened by metabolic inhibition. J Biol Chem. 1999;274(1):236–40.

    CAS  PubMed  Google Scholar 

  70. Saez JC, Berthoud VM, Branes MC, Martinez AD, Beyer EC. Plasma membrane channels formed by connexins: their regulation and functions. Physiol Rev. 2003;83(4):1359–400.

    CAS  PubMed  Google Scholar 

  71. Cauwels A, Rogge E, Vandendriessche B, Shiva S, Brouckaert P. Extracellular ATP drives systemic inflammation, tissue damage and mortality. Cell Death Dis. 2014;5(3):e1102.

    CAS  PubMed  PubMed Central  Google Scholar 

  72. Calder BW, Matthew Rhett J, Bainbridge H, Fann SA, Gourdie RG, Yost MJ. Inhibition of connexin 43 hemichannel-mediated ATP release attenuates early inflammation during the foreign body response. Tissue Eng Part A. 2015;21(11–12):1752–62.

    CAS  PubMed  PubMed Central  Google Scholar 

  73. Eltzschig HK, Eckle T, Mager A, Kuper N, Karcher C, Weissmuller T, et al. ATP release from activated neutrophils occurs via connexin 43 and modulates adenosine-dependent endothelial cell function. Circ Res. 2006;99(10):1100–8.

    CAS  PubMed  Google Scholar 

  74. Price GW, Chadjichristos CE, Kavvadas P, Tang SCW, Yiu WH, Green CR, et al. Blocking Connexin-43 mediated hemichannel activity protects against early tubular injury in experimental chronic Kidney Disease. Cell Commun Signal. 2020;18(1):79.

    CAS  PubMed  PubMed Central  Google Scholar 

  75. Wauters E, Van Mol P, Garg AD, Jansen S, Van Herck Y, Vanderbeke L, et al. Discriminating mild from critical COVID-19 by innate and adaptive immune single-cell profiling of bronchoalveolar lavages. Cell Res. 2021;31(3):272–90.

    CAS  PubMed  PubMed Central  Google Scholar 

  76. De Bock M, Wang N, Bol M, Decrock E, Ponsaerts R, Bultynck G, et al. Connexin 43 hemichannels contribute to cytoplasmic Ca2 + oscillations by providing a bimodal Ca2+-dependent Ca2 + entry pathway. J Biol Chem. 2012;287(15):12250–66.

    PubMed  PubMed Central  Google Scholar 

  77. Fiori MC, Figueroa V, Zoghbi ME, Saez JC, Reuss L, Altenberg GA. Permeation of calcium through purified connexin 26 hemichannels. J Biol Chem. 2012;287(48):40826–34.

    CAS  PubMed  PubMed Central  Google Scholar 

  78. Schalper KA, Sanchez HA, Lee SC, Altenberg GA, Nathanson MH, Saez JC. Connexin 43 hemichannels mediate the Ca2 + influx induced by extracellular alkalinization. Am J Physiol Cell Physiol. 2010;299(6):C1504–15.

    CAS  PubMed  PubMed Central  Google Scholar 

  79. Gerasimenko JV, Petersen OH, Gerasimenko OV. SARS-CoV-2 S protein subunit 1 elicits ca(2+) influx - dependent ca(2+) signals in pancreatic stellate cells and macrophages in situ. Function (Oxf). 2022;3(2):zqac002.

    PubMed  Google Scholar 

  80. Li F, Li J, Wang PH, Yang N, Huang J, Ou J, et al. SARS-CoV-2 spike promotes inflammation and apoptosis through autophagy by ROS-suppressed PI3K/AKT/mTOR signaling. Biochim Biophys Acta Mol Basis Dis. 2021;1867(12):166260.

    CAS  PubMed  PubMed Central  Google Scholar 

  81. Fruhbeck G, Catalan V, Valenti V, Moncada R, Gomez-Ambrosi J, Becerril S, et al. FNDC4 and FNDC5 reduce SARS-CoV-2 entry points and spike glycoprotein S1-induced pyroptosis, apoptosis, and necroptosis in human adipocytes. Cell Mol Immunol. 2021;18(10):2457–9.

    CAS  PubMed  PubMed Central  Google Scholar 

  82. Barhoumi T, Alghanem B, Shaibah H, Mansour FA, Alamri HS, Akiel MA, et al. SARS-CoV-2 Coronavirus Spike Protein-Induced apoptosis, inflammatory, and oxidative stress responses in THP-1-Like-Macrophages: potential role of angiotensin-converting enzyme inhibitor (Perindopril). Front Immunol. 2021;12:728896.

    CAS  PubMed  PubMed Central  Google Scholar 

  83. Saez JC, Contreras-Duarte S, Labra VC, Santibanez CA, Mellado LA, Inostroza CA, et al. Interferon-Gamma and high glucose-induced opening of Cx43 hemichannels causes endothelial cell dysfunction and damage. Biochim Biophys Acta Mol Cell Res. 2020;1867(8):118720.

    CAS  PubMed  Google Scholar 

  84. Ramadan R, Vromans E, Anang DC, Goetschalckx I, Hoorelbeke D, Decrock E, et al. Connexin43 Hemichannel Targeting with TAT-Gap19 alleviates Radiation-Induced endothelial cell damage. Front Pharmacol. 2020;11:212.

    CAS  PubMed  PubMed Central  Google Scholar 

  85. Saez PJ, Orellana JA, Vega-Riveros N, Figueroa VA, Hernandez DE, Castro JF, et al. Disruption in connexin-based communication is associated with intracellular ca(2)(+) signal alterations in astrocytes from Niemann-pick type C mice. PLoS ONE. 2013;8(8):e71361.

    CAS  PubMed  PubMed Central  Google Scholar 

  86. Hoorelbeke D, Decrock E, De Smet M, De Bock M, Descamps B, Van Haver V, et al. Cx43 channels and signaling via IP(3)/Ca(2+), ATP, and ROS/NO propagate radiation-induced DNA damage to non-irradiated brain microvascular endothelial cells. Cell Death Dis. 2020;11(3):194.

    CAS  PubMed  PubMed Central  Google Scholar 

  87. Saez JC, Contreras-Duarte S, Gomez GI, Labra VC, Santibanez CA, Gajardo-Gomez R, et al. Connexin 43 Hemichannel Activity promoted by pro-inflammatory cytokines and high glucose alters endothelial cell function. Front Immunol. 2018;9:1899.

    PubMed  PubMed Central  Google Scholar 

  88. Baroja-Mazo A, Barbera-Cremades M, Pelegrin P. The participation of plasma membrane hemichannels to purinergic signaling. Biochim Biophys Acta. 2013;1828(1):79–93.

    CAS  PubMed  Google Scholar 

  89. Yang K, Liu S, Yan H, Lu W, Shan X, Chen H, et al. SARS-CoV-2 spike protein receptor-binding domain perturbates intracellular calcium homeostasis and impairs pulmonary vascular endothelial cells. Signal Transduct Target Ther. 2023;8(1):276.

    CAS  PubMed  PubMed Central  Google Scholar 

  90. Olajide OA, Iwuanyanwu VU, Adegbola OD, Al-Hindawi AA. SARS-CoV-2 Spike glycoprotein S1 induces neuroinflammation in BV-2 microglia. Mol Neurobiol. 2022;59(1):445–58.

    CAS  PubMed  Google Scholar 

  91. Prieto-Villalobos J, Alvear TF, Liberona A, Lucero CM, Martinez-Araya CJ, Balmazabal J et al. Astroglial hemichannels and pannexons: the hidden link between maternal inflammation and neurological disorders. Int J Mol Sci. 2021;22(17).

  92. Kim Y, Davidson JO, Gunn KC, Phillips AR, Green CR, Gunn AJ. Role of Hemichannels in CNS inflammation and the Inflammasome Pathway. Adv Protein Chem Struct Biol. 2016;104:1–37.

    CAS  PubMed  Google Scholar 

  93. Klein NP, Lewis N, Goddard K, Fireman B, Zerbo O, Hanson KE, et al. Surveillance for adverse events after COVID-19 mRNA vaccination. JAMA. 2021;326(14):1390–9.

    CAS  PubMed  Google Scholar 

  94. Patone M, Handunnetthi L, Saatci D, Pan J, Katikireddi SV, Razvi S, et al. Neurological Complications after first dose of COVID-19 vaccines and SARS-CoV-2 Infection. Nat Med. 2021;27(12):2144–53.

    CAS  PubMed  PubMed Central  Google Scholar 

  95. Moghimi SM. Allergic reactions and Anaphylaxis to LNP-Based COVID-19 vaccines. Mol Ther. 2021;29(3):898–900.

    CAS  PubMed  PubMed Central  Google Scholar 

  96. Risma KA, Edwards KM, Hummell DS, Little FF, Norton AE, Stallings A, et al. Potential mechanisms of anaphylaxis to COVID-19 mRNA vaccines. J Allergy Clin Immunol. 2021;147(6):2075–82. e2.

    CAS  PubMed  PubMed Central  Google Scholar 

  97. Beyerstedt S, Casaro EB, Rangel EB. COVID-19: angiotensin-converting enzyme 2 (ACE2) expression and tissue susceptibility to SARS-CoV-2 Infection. Eur J Clin Microbiol Infect Dis. 2021;40(5):905–19.

    CAS  PubMed  PubMed Central  Google Scholar 

Download references

Acknowledgements

Not applicable.

Funding

This work was supported by the Fondo Nacional de Desarrollo Científico y Tecnológico (FONDECYT) Grant 1210375 (to JAO) and Fondo DIDEMUC UC SARS-CoV-2 Grant SC-02 (to JAO and MR).

Author information

Author notes

  1. Juan Prieto-Villalobos and Claudia M. Lucero contributed equally to this work.

Authors and Affiliations

  1. Departamento de Neurología, Escuela de Medicina and Centro Interdisciplinario de Neurociencias, Facultad de Medicina, Pontificia Universidad Católica de Chile, Marcoleta 391, Santiago, Chile

    Juan Prieto-Villalobos & Juan A. Orellana

  2. Institute of Biomedical Sciences, Faculty of Health Sciences, Universidad Autónoma de Chile, Santiago, Chile

    Claudia M. Lucero & Gonzalo I. Gómez

  3. Departamento de Medicina Intensiva, Facultad de Medicina, Pontificia Universidad Católica de Chile, Santiago, Chile

    Maximiliano Rovegno

  4. Programa de Comunicación Celular en Cancer, Facultad de Medicina Clínica Alemana, Universidad del Desarrollo, Santiago, Chile

    Mauricio A. Retamal

Authors
  1. Juan Prieto-Villalobos
    View author publications

    You can also search for this author in PubMed Google Scholar

  2. Claudia M. Lucero
    View author publications

    You can also search for this author in PubMed Google Scholar

  3. Maximiliano Rovegno
    View author publications

    You can also search for this author in PubMed Google Scholar

  4. Gonzalo I. Gómez
    View author publications

    You can also search for this author in PubMed Google Scholar

  5. Mauricio A. Retamal
    View author publications

    You can also search for this author in PubMed Google Scholar

  6. Juan A. Orellana
    View author publications

    You can also search for this author in PubMed Google Scholar

Contributions

JAO, MAR and MR conceived and designed the experiments. JP-V, CML and MAR performed the experiments. JP-V, CML, MAR and JAO analyzed the data. JAO, MAR and GIG contributed reagents/materials/analysis tools. JAO, MAR, MR and GIG wrote and edited the paper.

Corresponding authors

Correspondence to Mauricio A. Retamal or Juan A. Orellana.

Ethics declarations

Ethics approval and consent to participate

Not applicable.

Consent for publication

Not applicable.

Competing interests

The authors declare that they have no competing interests.

Additional information

Publisher’s Note

Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Electronic supplementary material

Below is the link to the electronic supplementary material.

Supplementary Material 1

Supplementary Material 2

Rights and permissions

Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data.

Reprints and permissions

About this article

Check for updates. Verify currency and authenticity via CrossMark

Cite this article

Prieto-Villalobos, J., Lucero, C.M., Rovegno, M. et al. SARS-CoV-2 spike protein S1 activates Cx43 hemichannels and disturbs intracellular Ca2+ dynamics. Biol Res 56, 56 (2023). https://doi.org/10.1186/s40659-023-00468-9

Download citation

  • Received:

  • Accepted:

  • Published:

  • DOI: https://doi.org/10.1186/s40659-023-00468-9

Keywords

Biological Research

ISSN: 0717-6287

Contact us